Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Tat-beclin 1

SKU: orb1140642

Description

Autophagy inducing peptide; Cell penetrating peptides.

Research Area

Product Categories/Products/Proteins,Product Categories/Products/Proteins/Peptides,Protein-protein interactions,Antivirals

Images & Validation

−

Key Properties

−
CAS Number1423821-88-8
MW3741.15 Da
Purity> 95% by hplc
FormulaC164H251N57O45
Protein SequenceYGRKKRRQRRRGGTNVFNATFEIWHDGEFGT

Storage & Handling

−
StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, beclin 1 peptide

Similar Products

−
  • Tat-beclin 1 [orb1691716]

    98%

    1423821-88-8

    50 mg
  • Tat-beclin 1 TFA [orb1981403]

    98.00%

    3855.12

    C166H252F3N57O47

    50 mg, 5 mg
  • Tat-beclin 1 acetate [orb1303607]

    99.44%

    500 mg, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 270.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry