You have no items in your shopping cart.
Description
Research Area
Product Categories/Research Tools,Product Categories/Products/Proteins,Cytokines
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | ED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | 24~26kDa, observed by reducing SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE. |
| Protein Sequence | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Storage & Handling
−| Storage | Lyophilized recombinant Human Cardiotrophin-1°CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1°CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CT1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days