You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Rattus norvegicus (Rat) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 136-243aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 16.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Abrineurin protein, BDNF protein, Brain Derived Neurotrophic Factor protein, Brain-derived neurotrophic factor protein, Neurotrophin protein
Similar Products
−- Item 1 of 1
Human/Murine/Rat BDNF Protein [orb1471779]
Greater than 95% as determined by reducing SDS-PAGE.
13 KDa
Mammalian
10 μg, 50 μg Rat BDNF Protein [orb1473264]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human Neurotrophin-4 (rHuNT-4 ) [orb1495027]
> 97% by SDS-PAGE and HPLC analyses.
28 kDa, a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues).
Escherichia coli.
1 mg, 10 μg, 2 μgBDNF Protein, Human/Murine/Rat, Recombinant [orb1962089]
> 99.9%
14 KDa (reducing condition)
500 μg, 1 mg, 10 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks