mClover Antibody

SKU: orb1463265

Description

Goat polyclonal antibody to mClover (Clover fluorescent protein). mClover is a basic (constitutively fluorescent), monomeric engineered derivate of green fluorescent protein (GFP) isolated from Aequorea victoria

Images & Validation

−

Item 1 of 2

Tested Applications	IEM, IF, IHC-Fr, IHC-P, WB
Dilution Range	WB 1:500-1:5,000, IHC 1:50-1:500, 1:50-1:500, IEM 1:50-1:500
Application Notes	In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize RFP (red fluorescent protein)

Key Properties

−

Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Target	Green Fluorescent Protein
Purity	This antibody is epitope-affinity purified from goat antiserum
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	For continuous use, store at 2-8 C for one to two days. For extended storage, store in a -20 C freezer. Working dilution samples should be discarded if not used within 12 hours
Form/Appearance	Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

green fluorescent protein antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].