Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IKBKB Rabbit Polyclonal Antibody

SKU: orb329679

Description

Rabbit polyclonal antibody to IKBKB

Research Area

Product Categories/Antibodies/Primary Antibodies,Signaling Pathways,Neuroscience,Signaling Pathways/NF-kB,Epigenetics,Infectious Diseases,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Factor,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Cell Biology,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/Signal Transduction,Root Catalog/Research Areas/E3 & Ubiquitin,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Phosphorylation,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

−
Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

−

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IKBKB
TargetIKBKB
Protein SequenceSynthetic peptide located within the following region: CITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNN
Molecular Weight86kDa
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
anti FLJ40509 antibody, anti IKK-beta antibody, anti IKK2 antibody, anti IKKB antibody, anti MGC131801 antibody, anti NFKBIKB antibody

Similar Products

−
  • Phospho-IKK beta (Tyr199) Rabbit Polyclonal Antibody [orb5519]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Phospho-IKK beta (Tyr188) Rabbit Polyclonal Antibody [orb5517]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • Phospho-IKK alpha/beta (Ser176 + Ser180) Rabbit Polyclonal Antibody [orb5516]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IKK Alpha + IKK beta Rabbit Polyclonal Antibody [orb157675]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IKKβ (phospho Tyr188) rabbit pAb [orb768740]

    ELISA,  IHC-P,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001547

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry