You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2 |
| Target | IGF2BP2 |
| Protein Sequence | Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS |
| Molecular Weight | 66kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody
Similar Products
−IGF2BP2 Antibody (C-term) [orb1787909]
FC, IHC-P, WB
Mouse
Human
Rabbit
Polyclonal
Unconjugated
Anti-IGF2BP2 Antibody [orb412129]
IF, IH, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].


















