You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 82-190aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 14.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant human PDGF R Beta protein, C-His-Avi (HEK293) [orb1516344]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. kDa
50 μgRecombinant human PDGF R Beta protein, C-His-Avi (HEK293), Biotin conjugated [orb2328734]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-115 kDa based on Tris-Bis PAGE result. kDa
20 μgHuman PDGFRB Protein [orb1477114]
Greater than 85% as determined by SDS-PAGE.
54.6 kDa
E.coli
1 mg, 20 μg, 100 μgHuman PDGF B protein [orb604301]
Greater than 85% as determined by SDS-PAGE.
28.3 kDa
E.coli
100 μg, 1 mg, 20 μgHuman PDGF B protein [orb594736]
Greater than 98% as determined by SDS-PAGE.
12.42 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].



