You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Cancer
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody, the EC50 is 49.61-69.45 ng/ml. |
| Tag | C-terminal hFc-tagged |
| Expression Region | 2-115aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| MW | 41.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase)
Similar Products
−Human Anti-Mullerian Hormone (AMH) EasyStep ELISA Kit [orb1817405]
Human
0.32-20 ng/mL
0.028 ng/mL
96 T, 48 THuman S100 Calcium Binding Protein A8 (S100A8) ELISA Kit [orb1807231]
Human
0.63-40ng/mL
0.239 ng/mL
48 T, 96 THuman S100 Calcium Binding Protein A9 (S100A9) ELISA Kit [orb1807230]
Human
0.78-50ng/mL
0.47 ng/mL
48 T, 96 THuman S100 Calcium Binding Protein A8 (S100A8) ELISA Kit [orb2668098]
0.78-50 ng/mL
0.31 ng/mL
48 T, 96 THuman S100 Calcium Binding Protein A9 (S100A9) ELISA Kit [orb2667937]
0.16-10 ng/mL
0.069 ng/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





