You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Expression Region | 49-184aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 50.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | GAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Fc Fragment of IgG Low Affinity Ⅲb Receptor (FcγR3B) ELISA Kit [orb1948681]
Human
0.32-20ng/mL
0.19 ng/mL
48 T, 96 THuman FCGR3A Protein (F176V), His Tag [orb689417]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 22.3 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μgFCGR3A purified MaxPab rabbit polyclonal antibody (D01P) [orb2293077]
PLA, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μgHuman FCGR3B Protein, His Tag [orb1743278]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 21.6 kDa after removal of the signal peptide.
E.coli
50 μg, 100 μg, 10 μgHuman FCGR3B Protein, hFc Tag [orb1743281]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.9 kDa after removal of the signal peptide. The apparent molecular mass of FCGR3B-hFc is approximately 55-100 kDa due to glycosylation.
E.coli
50 μg, 100 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].








