You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 35-107aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 11.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−C-X-C motif chemokine 1, GRO-alpha(1-73)Melanoma growth stimulatory activity , MGSANeutrophil-activating protein 3 , NAP-3
Similar Products
−Human Growth Regulated Oncogene Alpha (GROa/CXCL1) ELISA Kit [orb774889]
Human
15.63-1000 pg/mL
5.8 pg/mL
48 T, 96 THuman Growth Regulated Oncogene Alpha (GROα/CXCL1) Microsample Fast ELISA Kit [orb1806737]
Human
15.63-1000pg/mL
9.38 pg/mL
48 T, 96 THuman Growth Regulated Oncogene Alpha (GROα/CXCL1) ELISA Kit [orb1807489]
Human
15.63-1000pg/mL
5.47 pg/mL
48 T, 96 TRecombinant Human Growth Regulated Protein-alpha/CXCL1 [orb1906091]
> 97 % by SDS-PAGE and HPLC analyses.
Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Escherichia coli
500 μg, 5 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



