Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HSD3B6 Antibody

SKU: orb592071

Description

Rabbit polyclonal antibody to HSD3B6

Images & Validation

−
Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityMouse

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B6
TargetHSD3B6
Protein SequenceSynthetic peptide located within the following region: VYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLS
Molecular Weight42 kDa
PurificationAffinity purified
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
D19210
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Filter by Applications

Filter by Species

Maria Sindhura John, Mahendran Chinnappan, Methinee Artami, Mohini Bhattacharya, Rebecca A Keogh, Jeffrey Kavanaugh, Tripti Sharma, Alexander R Horswill, Tamia A Harris-Tryon Androgens at the skin surface regulate S. aureus pathogenesis through the activation of agr quorum sensing bioRxiv, (2024)

Applications

IF

Reactivity

Mouse

MS John, M Chinnappan, M Artami, M Bhattacharya, RA Keogh, J Kavanaugh, T Sharma Androgens at the skin surface regulate S. aureus pathogenesis through the activation of agr quorum sensing bioRxiv,, (2024)

Applications

IF

Reactivity

Mouse

Available Sizes

Select a size below

Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.